PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G07440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 204aa    MW: 23136.5 Da    PI: 10.0897
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G07440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.43.8e-144086148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEde l + v+ +G   W+ Ia+ +    t+kqc++rw ++l
  OBART07G07440.1 40 KGGWTREEDEVLRQMVRHHGDCKWTEIAKSLL-SQTGKQCRERWTNHL 86
                     688****************************9.************996 PP

2Myb_DNA-binding33.41e-1093130645
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +eE+ +l+++++ +G++ W++I r +  gR+++ +k++w+
  OBART07G07440.1  93 EEEHMKLIEVHRTYGNR-WSAIVRWLL-GRSENTVKNHWN 130
                      7****************.********9.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.0383590IPR017930Myb domain
SuperFamilySSF466894.69E-2537129IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-183792IPR009057Homeodomain-like
SMARTSM007171.4E-123988IPR001005SANT/Myb domain
PfamPF002493.2E-134086IPR001005SANT/Myb domain
CDDcd001672.66E-134386No hitNo description
SMARTSM007170.005993135IPR001005SANT/Myb domain
CDDcd001678.47E-793130No hitNo description
Gene3DG3DSA:1.10.10.608.0E-1193130IPR009057Homeodomain-like
PfamPF002495.6E-993130IPR001005SANT/Myb domain
PROSITE profilePS500906.95793130IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MAPSSFRTPR KGLTTASYNS VVAFLQMQAA GSNGNLGLIK GGWTREEDEV LRQMVRHHGD  60
CKWTEIAKSL LSQTGKQCRE RWTNHLYSEI KIEEEHMKLI EVHRTYGNRW SAIVRWLLGR  120
SENTVKNHWN PTKRSLNSKQ RLRKKNSEKA APGQPSHLEE CICSFQNPLL DETAPPPLAP  180
PAPFDIVRYG TCRLIGVIPT PPAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27381385110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankDQ9896280.0DQ989628.1 Oryza sativa (indica cultivar-group) clone BAC 21O9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.12e-88PREDICTED: transcription factor RAX1-like
SwissprotQ9S7L23e-30MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0D3GNQ41e-152A0A0D3GNQ4_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g12130.18e-88(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.17e-33myb domain protein 118